Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Jun Rabbit pAb (APR18434N)

Product Specifications

Background

This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality c-Jun Rabbit pAb (APR18431N8) .

Synonyms

AP-1; AP1; c-Jun; JUN; c

Gene ID

3725

UniProt

P05412

Cellular Locus

Nucleus

Applications

IHC (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 43KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3725

Uniprot URL

https://www.uniprot.org/uniprot/P05412

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF4 (Tumor Necrosis Factor Receptor Superfamily Member 4, ACT35 Antigen, OX40L Receptor, TAX Transcriptionally-activated Glycoprotein 1 Receptor, CD134, TNFRSF4, TXGP1L) discontinued
361340-01 50 µL

TNFRSF4 (Tumor Necrosis Factor Receptor Superfamily Member 4, ACT35 Antigen, OX40L Receptor, TAX Transcriptionally-activated Glycoprotein 1 Receptor, CD134, TNFRSF4, TXGP1L) discontinued

Sign In for Pricing
View Details
TNFRSF4 (Tumor Necrosis Factor Receptor Superfamily Member 4, ACT35 Antigen, OX40L Receptor, TAX Transcriptionally-activated Glycoprotein 1 Receptor, CD134, TNFRSF4, TXGP1L) discontinued
361340-02 100 µL

TNFRSF4 (Tumor Necrosis Factor Receptor Superfamily Member 4, ACT35 Antigen, OX40L Receptor, TAX Transcriptionally-activated Glycoprotein 1 Receptor, CD134, TNFRSF4, TXGP1L) discontinued

Sign In for Pricing
View Details
Caspase 1 Cell-Based ELISA Kit
CB5098 1 Kit

Caspase 1 Cell-Based ELISA Kit

Sign In for Pricing
View Details
Olfr172 Mouse shRNA Plasmid (Locus ID 259003)
TL507980 1 Kit

Olfr172 Mouse shRNA Plasmid (Locus ID 259003)

Sign In for Pricing
View Details
anti-ISG20
YF-PA12780 100 ul

anti-ISG20

Sign In for Pricing
View Details
Mouse Vitamin H ELISA Kit
MBS7200073-01 48 Well

Mouse Vitamin H ELISA Kit

Sign In for Pricing
View Details