Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Jun Rabbit pAb (APR18434N)

Product Specifications

Background

This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality c-Jun Rabbit pAb (APR18431N8) .

Synonyms

AP-1; AP1; c-Jun; JUN; c

Gene ID

3725

UniProt

P05412

Cellular Locus

Nucleus

Applications

IHC (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 43KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3725

Uniprot URL

https://www.uniprot.org/uniprot/P05412

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cytochrome P450 2C13, male-specific (CYP2C13) ELISA Kit
abx508263 96 Tests

Rat Cytochrome P450 2C13, male-specific (CYP2C13) ELISA Kit

Sign In for Pricing
View Details
AIF CRISPR/Cas9 KO Plasmid (m)
sc-424143 20 µg

AIF CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
GRK4 Polyclonal Antibody
A50269-050 50 µL

GRK4 Polyclonal Antibody

Sign In for Pricing
View Details
2- (5-Chloropyridin-2-yl) acetic acid
OR946636-01 100 mg

2- (5-Chloropyridin-2-yl) acetic acid

Sign In for Pricing
View Details
2- (5-Chloropyridin-2-yl) acetic acid
OR946636-02 250 mg

2- (5-Chloropyridin-2-yl) acetic acid

Sign In for Pricing
View Details
Rat Potassium voltage-gated channel subfamily KQT member 4, KCNQ4 ELISA Kit
MBS9338526-01 48 Well

Rat Potassium voltage-gated channel subfamily KQT member 4, KCNQ4 ELISA Kit

Sign In for Pricing
View Details