Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] β-Catenin Rabbit pAb (APR18419N)

Product Specifications

Background

The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs) . AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] β-Catenin Rabbit pAb (APR18418N3) .

Synonyms

CTNNB; MRD19; armadillo; beta Catenin; CTNNB1

Gene ID

1499

UniProt

P35222

Cellular Locus

Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole

Applications

IHC (Human chronic myeloid leukemia cells) IF (Human chronic myeloid leukemia cells, ADSCs) WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa/85kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1499

Uniprot URL

https://www.uniprot.org/uniprot/P35222

AA Sequence

GVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ACVRL1, NT (ACVRL1, ACVRLK1, ALK1, Serine/threonine-protein kinase receptor R3, Activin receptor-like kinase 1, TGF-B superfamily receptor type I)
MBS641713-01 0.2 mL

ACVRL1, NT (ACVRL1, ACVRLK1, ALK1, Serine/threonine-protein kinase receptor R3, Activin receptor-like kinase 1, TGF-B superfamily receptor type I)

Ask
View Details
ACVRL1, NT (ACVRL1, ACVRLK1, ALK1, Serine/threonine-protein kinase receptor R3, Activin receptor-like kinase 1, TGF-B superfamily receptor type I)
MBS641713-02 5x 0.2 mL

ACVRL1, NT (ACVRL1, ACVRLK1, ALK1, Serine/threonine-protein kinase receptor R3, Activin receptor-like kinase 1, TGF-B superfamily receptor type I)

Ask
View Details
CORO2A (NM_052820) Human Tagged Lenti ORF Clone
RC203993L3 10 µg

CORO2A (NM_052820) Human Tagged Lenti ORF Clone

Ask
View Details
Rabbit anti-TCPl Antibody, Affinity Purified
A303-445A-T 2 µg

Rabbit anti-TCPl Antibody, Affinity Purified

Ask
View Details
SEPHS1P3 Adenovirus (Human)
43382051 1.0 mL

SEPHS1P3 Adenovirus (Human)

Ask
View Details