Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H4 Rabbit pAb (APR18407N)

Product Specifications

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4) . The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Histone H4 Rabbit pAb (APR18407N) .

Synonyms

H4FA; Histone H4; HIST1H4A; HIST4H4; H4/p

Gene ID

8359

UniProt

P62805

Applications

WB (U87MG, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa Observed MW: 11kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8359

Uniprot URL

https://www.uniprot.org/uniprot/P62805

AA Sequence

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AP2A1 (adaptor-related protein complex 2, alpha 1 subunit, AP-2, ADTAA, Alpha-adaptin A, AP2-ALPHA, AP-2 complex subunit alpha-1, CLAPA1, Clathrin assembly protein complex 2 alpha-A large chain, Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit)
MBS604575-01 0.1 mg

AP2A1 (adaptor-related protein complex 2, alpha 1 subunit, AP-2, ADTAA, Alpha-adaptin A, AP2-ALPHA, AP-2 complex subunit alpha-1, CLAPA1, Clathrin assembly protein complex 2 alpha-A large chain, Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit)

Ask
View Details
AP2A1 (adaptor-related protein complex 2, alpha 1 subunit, AP-2, ADTAA, Alpha-adaptin A, AP2-ALPHA, AP-2 complex subunit alpha-1, CLAPA1, Clathrin assembly protein complex 2 alpha-A large chain, Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit)
MBS604575-02 5x 0.1 mg

AP2A1 (adaptor-related protein complex 2, alpha 1 subunit, AP-2, ADTAA, Alpha-adaptin A, AP2-ALPHA, AP-2 complex subunit alpha-1, CLAPA1, Clathrin assembly protein complex 2 alpha-A large chain, Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit)

Ask
View Details
Human Cathepsin F (CTSF) ELISA Kit
MBS9312568-01 48 Well

Human Cathepsin F (CTSF) ELISA Kit

Ask
View Details
Human Cathepsin F (CTSF) ELISA Kit
MBS9312568-02 96 Well

Human Cathepsin F (CTSF) ELISA Kit

Ask
View Details
Human Cathepsin F (CTSF) ELISA Kit
MBS9312568-03 5x 96 Well

Human Cathepsin F (CTSF) ELISA Kit

Ask
View Details
Human Cathepsin F (CTSF) ELISA Kit
MBS9312568-04 10x 96 Well

Human Cathepsin F (CTSF) ELISA Kit

Ask
View Details