Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOA1 Rabbit pAb (APR18405N)

Product Specifications

Background

This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality APOA1 Rabbit pAb (APR18405N) .

Synonyms

APOA1; apo (a)

Gene ID

335

UniProt

P02647

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 30kDa Observed MW: 26KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=335

Uniprot URL

https://www.uniprot.org/uniprot/P02647

AA Sequence

HFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEMD2, NT (LEMD2, LEM domain-containing protein 2) (APC) discontinued
037733-APC 200 µL

LEMD2, NT (LEMD2, LEM domain-containing protein 2) (APC) discontinued

Sign In for Pricing
View Details
PIEZO2 CRISPR Activation Plasmid (h)
sc-412957-ACT 20 µg

PIEZO2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Rabbit anti-FAM111A Antibody
DL99013A-01 50 µL

Rabbit anti-FAM111A Antibody

Sign In for Pricing
View Details
Rabbit anti-FAM111A Antibody
DL99013A-02 100 µL

Rabbit anti-FAM111A Antibody

Sign In for Pricing
View Details
MAP-9 CRISPR Activation Plasmid (h2)
sc-407978-ACT-2 20 µg

MAP-9 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Human Serine/threonine-protein kinase SIK1 ELISA Kit
MBS762710-01 48 Well

Human Serine/threonine-protein kinase SIK1 ELISA Kit

Sign In for Pricing
View Details