Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRH Rabbit pAb (APR18379N)

Product Specifications

Background

This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus, binds to corticotropin releasing hormone receptors and stimulates the release of adrenocorticotropic hormone from the pituitary gland. Marked reduction in this protein has been observed in association with Alzheimer's disease. Autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of the hormone occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, this protein may act as a trigger for parturition.

Synonyms

CRH; CRF; CRH1

Gene ID

1392

UniProt

P06850

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CRH Rabbit pAb (APR18379N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1392

Uniprot URL

https://www.uniprot.org/uniprot/P06850

AA Sequence

LLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UCHL1 Antibody
K52010C14C05C-01 50 ug

UCHL1 Antibody

Ask
View Details
UCHL1 Antibody
K52010C14C05C-02 100 ug

UCHL1 Antibody

Ask
View Details
UCHL1 Antibody
K52010C14C05C-03 1 mg

UCHL1 Antibody

Ask
View Details
PKM2, CT (Pyruvate Kinase, Isozymes M1/M2, Pyruvate Kinase Muscle Isozyme, Cytosolic Thyroid Hormone-binding Protein, CTHBP, Opa-interacting Protein 3, OIP-3, Pyruvate Kinase 2/3, Thyroid Hormone-binding Protein 1, THBP1, Tumor M2-PK, p58, PKM, OIP3, PK2,
MBS6496283-01 0.1 mL

PKM2, CT (Pyruvate Kinase, Isozymes M1/M2, Pyruvate Kinase Muscle Isozyme, Cytosolic Thyroid Hormone-binding Protein, CTHBP, Opa-interacting Protein 3, OIP-3, Pyruvate Kinase 2/3, Thyroid Hormone-binding Protein 1, THBP1, Tumor M2-PK, p58, PKM, OIP3, PK2,

Ask
View Details
PKM2, CT (Pyruvate Kinase, Isozymes M1/M2, Pyruvate Kinase Muscle Isozyme, Cytosolic Thyroid Hormone-binding Protein, CTHBP, Opa-interacting Protein 3, OIP-3, Pyruvate Kinase 2/3, Thyroid Hormone-binding Protein 1, THBP1, Tumor M2-PK, p58, PKM, OIP3, PK2,
MBS6496283-02 5x 0.1 mL

PKM2, CT (Pyruvate Kinase, Isozymes M1/M2, Pyruvate Kinase Muscle Isozyme, Cytosolic Thyroid Hormone-binding Protein, CTHBP, Opa-interacting Protein 3, OIP-3, Pyruvate Kinase 2/3, Thyroid Hormone-binding Protein 1, THBP1, Tumor M2-PK, p58, PKM, OIP3, PK2,

Ask
View Details
NDRG1 Over-expression Lysate Product
GWB-74AE72 0.1 mg

NDRG1 Over-expression Lysate Product

Ask
View Details