Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NF-kB p65/RelA Rabbit pAb (APR18374N)

Product Specifications

Background

NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NF-kB p65/RelA Rabbit pAb (APR18373N1) .

Synonyms

NFKB3; p65; NF-kB p65; RELA; CMCU

Gene ID

5970

UniProt

Q04206

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 58kDa/59kDa/60kDa Observed MW: 65KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5970

Uniprot URL

https://www.uniprot.org/uniprot/Q04206

AA Sequence

LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCR4-TOPO-ANGPT2 Plasmid
PVT33229 2 µg

pCR4-TOPO-ANGPT2 Plasmid

Sign In for Pricing
View Details
Human MIR582 qPCR Primer Pair
QH81449S 200 Tests

Human MIR582 qPCR Primer Pair

Sign In for Pricing
View Details
Dsg1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3277207 1.0 µg DNA

Dsg1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TIA1 AAV Vector (Mouse) (CMV)
46685105 1 µg

TIA1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Transcription Factor SOX-9 (SOX9) Antibody (Biotin)
abx315340-01 20 µg

Transcription Factor SOX-9 (SOX9) Antibody (Biotin)

Sign In for Pricing
View Details
Transcription Factor SOX-9 (SOX9) Antibody (Biotin)
abx315340-02 50 µg

Transcription Factor SOX-9 (SOX9) Antibody (Biotin)

Sign In for Pricing
View Details