Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NF-kB p65/RelA Rabbit pAb (APR18374N)

Product Specifications

Background

NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NF-kB p65/RelA Rabbit pAb (APR18373N1) .

Synonyms

NFKB3; p65; NF-kB p65; RELA; CMCU

Gene ID

5970

UniProt

Q04206

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 58kDa/59kDa/60kDa Observed MW: 65KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5970

Uniprot URL

https://www.uniprot.org/uniprot/Q04206

AA Sequence

LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Etoricoxib Impurity 61
RM-E044361-01 10 mg

Etoricoxib Impurity 61

Sign In for Pricing
View Details
Etoricoxib Impurity 61
RM-E044361-02 25 mg

Etoricoxib Impurity 61

Sign In for Pricing
View Details
Etoricoxib Impurity 61
RM-E044361-03 50 mg

Etoricoxib Impurity 61

Sign In for Pricing
View Details
Etoricoxib Impurity 61
RM-E044361-04 100 mg

Etoricoxib Impurity 61

Sign In for Pricing
View Details
Human Plexin B2 (PLXNB2) activation kit by CRISPRa
GA108463 1 Kit

Human Plexin B2 (PLXNB2) activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Bone Marrow Endothelial Primary Cells
CC7F796 5x 10^5 Cells/Vial

Rabbit Bone Marrow Endothelial Primary Cells

Sign In for Pricing
View Details