Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NF-kB p65/RelA Rabbit pAb (APR18374N)

Product Specifications

Background

NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NF-kB p65/RelA Rabbit pAb (APR18373N1) .

Synonyms

NFKB3; p65; NF-kB p65; RELA; CMCU

Gene ID

5970

UniProt

Q04206

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 58kDa/59kDa/60kDa Observed MW: 65KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5970

Uniprot URL

https://www.uniprot.org/uniprot/Q04206

AA Sequence

LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Histone H2a Protein - (Dry Ice)
H00008338-P01-10ug 10 µg

Recombinant Human Histone H2a Protein - (Dry Ice)

Sign In for Pricing
View Details
Mouse Monoclonal Ferritin Antibody (321B-7 (05)) [DyLight 405]
NB100-62560V 0.1 mL

Mouse Monoclonal Ferritin Antibody (321B-7 (05)) [DyLight 405]

Sign In for Pricing
View Details
Lentiviral human C11orf74 shRNA (UAS) - Lentiviral human C11orf74 shRNA (UAS) plasmid
GTR15129751 1 Vial

Lentiviral human C11orf74 shRNA (UAS) - Lentiviral human C11orf74 shRNA (UAS) plasmid

Sign In for Pricing
View Details
DAGLβ (A-5) P
sc-514738 P 100 µg - 0.5 mL

DAGLβ (A-5) P

Sign In for Pricing
View Details
LIMK1 / LIMK2 Antibody
abx329977-01 50 µg

LIMK1 / LIMK2 Antibody

Sign In for Pricing
View Details
LIMK1 / LIMK2 Antibody
abx329977-02 100 µg

LIMK1 / LIMK2 Antibody

Sign In for Pricing
View Details