Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pro-glucagon Rabbit pAb (APR18370N)

Product Specifications

Background

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Pro-glucagon Rabbit pAb (APR18370N) .

Synonyms

GCG; GLP-1; GLP1; GLP2; GRPP; glucagon

Gene ID

2641

UniProt

P01275

Cellular Locus

Secreted

Dilution

IHC 1:100 - 1:200 IF 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2641

Uniprot URL

https://www.uniprot.org/uniprot/P01275

AA Sequence

RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRA2 (Ankyrin Repeat Family A Protein 2, RFXANK-like Protein 2, ANKRA) (AP) discontinued
123334-AP 100 µL

ANKRA2 (Ankyrin Repeat Family A Protein 2, RFXANK-like Protein 2, ANKRA) (AP) discontinued

Sign In for Pricing
View Details
Melatonin Receptor Type 1B (Melatonin Receptor 1B, MTNR1B, Mel1b Receptor, Mel-1B-R, FGQTL2, MT2)
M2871-10E 50 µL

Melatonin Receptor Type 1B (Melatonin Receptor 1B, MTNR1B, Mel1b Receptor, Mel-1B-R, FGQTL2, MT2)

Sign In for Pricing
View Details
IFNP24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
59553111 3x 1.0 µg

IFNP24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human IgA1 Antibody : AP
OASB02537-1ML 1.0 mL

Human IgA1 Antibody : AP

Sign In for Pricing
View Details
GOLPH3 (GPP34) discontinued
509929 100 µg

GOLPH3 (GPP34) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal CD45 Antibody (rPTPRC/1147) [Allophycocyanin]
NBP3-21142APC 0.1 mL

Mouse Monoclonal CD45 Antibody (rPTPRC/1147) [Allophycocyanin]

Sign In for Pricing
View Details