Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pro-glucagon Rabbit pAb (APR18370N)

Product Specifications

Background

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Pro-glucagon Rabbit pAb (APR18370N) .

Synonyms

GCG; GLP-1; GLP1; GLP2; GRPP; glucagon

Gene ID

2641

UniProt

P01275

Cellular Locus

Secreted

Dilution

IHC 1:100 - 1:200 IF 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2641

Uniprot URL

https://www.uniprot.org/uniprot/P01275

AA Sequence

RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mphosph6 Rat siRNA Oligo Duplex (Locus ID 686999)
SR505586 1 Kit

Mphosph6 Rat siRNA Oligo Duplex (Locus ID 686999)

Sign In for Pricing
View Details
NCK1 (Cytoplasmic Protein Nck1, MGC12668, Nck1, Nck-1, Nck Adaptor Protein 1, SH2/SH3 Adaptor Protein NCK-alpha, SH2/SH3 Adaptor Protein NCK-alpha, NCK)
130176 100 µg

NCK1 (Cytoplasmic Protein Nck1, MGC12668, Nck1, Nck-1, Nck Adaptor Protein 1, SH2/SH3 Adaptor Protein NCK-alpha, SH2/SH3 Adaptor Protein NCK-alpha, NCK)

Sign In for Pricing
View Details
Human LRP6 (Low Density Lipoprotein Receptor Related Protein 6) Microsample ELISA Kit
ELK3363MS-01 48 Tests

Human LRP6 (Low Density Lipoprotein Receptor Related Protein 6) Microsample ELISA Kit

Sign In for Pricing
View Details
Human LRP6 (Low Density Lipoprotein Receptor Related Protein 6) Microsample ELISA Kit
ELK3363MS-02 96 Tests

Human LRP6 (Low Density Lipoprotein Receptor Related Protein 6) Microsample ELISA Kit

Sign In for Pricing
View Details
Human LRP6 (Low Density Lipoprotein Receptor Related Protein 6) Microsample ELISA Kit
ELK3363MS-03 5x 96 Tests

Human LRP6 (Low Density Lipoprotein Receptor Related Protein 6) Microsample ELISA Kit

Sign In for Pricing
View Details
Recombinant Human INHBC Protein, N-His
E55P1978 50 µg

Recombinant Human INHBC Protein, N-His

Sign In for Pricing
View Details