Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] ERK2 Rabbit pAb (APR18368N)

Product Specifications

Background

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] ERK2 Rabbit pAb (APR18364N6) .

Synonyms

ERK; ERK-2; ERK2; ERT1; MAPK2; P42MAPK; PRKM1; PRKM2; p38; p40; p41; p41mapk; p42-MAPK; MAPK1

Gene ID

5594

UniProt

P28482

Cellular Locus

Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center, spindle

Applications

IHC (Mouse embryonal fibroblast cell) WB (Mouse embryonal fibroblast cell, H460, Mus musculus, Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa/41kDa Observed MW: 42KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5594

Uniprot URL

https://www.uniprot.org/uniprot/P28482

AA Sequence

LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM40A (STRIP1) Mouse Monoclonal Antibody [Clone ID: OTI7B8]
TA502310S 30 µL

FAM40A (STRIP1) Mouse Monoclonal Antibody [Clone ID: OTI7B8]

Sign In for Pricing
View Details
Potassium Sorbate 99% Extrapure
02177 01000 1 Kg

Potassium Sorbate 99% Extrapure

Sign In for Pricing
View Details
Lrriq3 3'UTR GFP Stable Cell Line
TU162653 1.0 mL

Lrriq3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
OR56B1 Protein Vector (Human) (pPM-C-HA)
35369021 500 ng

OR56B1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ACTN2 Antibody, Biotin conjugated
MBS7136022-01 0.05 mL

ACTN2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ACTN2 Antibody, Biotin conjugated
MBS7136022-02 0.1 mL

ACTN2 Antibody, Biotin conjugated

Sign In for Pricing
View Details