Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NF-κB2 Rabbit pAb (APR18358N)

Product Specifications

Background

This gene encodes a subunit of the transcription factor complex nuclear factor-kappa-B (NFkB) . The NFkB complex is expressed in numerous cell types and functions as a central activator of genes involved in inflammation and immune function. The protein encoded by this gene can function as both a transcriptional activator or repressor depending on its dimerization partner. The p100 full-length protein is co-translationally processed into a p52 active form. Chromosomal rearrangements and translocations of this locus have been observed in B cell lymphomas, some of which may result in the formation of fusion proteins. There is a pseudogene for this gene on chromosome 18. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NF-κB2 Rabbit pAb (APR18358N) .

Synonyms

CVID10; H2TF1; LYT-10; LYT10; NF-kB2; p100; p49/p100; p52

Gene ID

4791

UniProt

Q00653

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 47kDa/96kDa Observed MW: 125kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4791

Uniprot URL

https://www.uniprot.org/uniprot/Q00653

AA Sequence

AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN2A Antibody
KC-162-01 50 μL

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
KC-162-02 100 µL

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
KC-162-03 1 mL

CDKN2A Antibody

Sign In for Pricing
View Details
CD33 Mouse Monoclonal Antibody [Clone ID: 2B7C12]
AM06271SU-N 100 µL

CD33 Mouse Monoclonal Antibody [Clone ID: 2B7C12]

Sign In for Pricing
View Details
LysoBrite™ NIR
22641-AAT 500 Tests

LysoBrite™ NIR

Sign In for Pricing
View Details
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), 0.2mg/mL
BNUB2651-500 1x 500 µL

Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), 0.2mg/mL

Sign In for Pricing
View Details