Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTCO2 Rabbit pAb (APR18354N)

Product Specifications

Background

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII, ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII and cytochrome c oxidase (complex IV, CIV, that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS are transferred via the dinuclear copper A center (CU (A of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC formed by heme A3 and copper B (CU (B. The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MTCO2 Rabbit pAb (APR18352N4) .

Synonyms

MT-CO2; COII; MTCO2; COX2

Gene ID

17709

UniProt

P00403

Cellular Locus

Mitochondrion inner membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa Observed MW: 24kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=17709

Uniprot URL

https://www.uniprot.org/uniprot/P00403

AA Sequence

MGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hlf (NM_172563) Mouse Tagged ORF Clone Lentiviral Particle
MR204073L3V 200 µL

Hlf (NM_172563) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
SCARF2, CT (SCARF2, SREC2, SREPCR, Scavenger receptor class F member 2, SRECRP-1, Scavenger receptor expressed by endothelial cells 2 protein) (MaxLight 550)
MBS6345246-01 0.1 mL

SCARF2, CT (SCARF2, SREC2, SREPCR, Scavenger receptor class F member 2, SRECRP-1, Scavenger receptor expressed by endothelial cells 2 protein) (MaxLight 550)

Ask
View Details
SCARF2, CT (SCARF2, SREC2, SREPCR, Scavenger receptor class F member 2, SRECRP-1, Scavenger receptor expressed by endothelial cells 2 protein) (MaxLight 550)
MBS6345246-02 5x 0.1 mL

SCARF2, CT (SCARF2, SREC2, SREPCR, Scavenger receptor class F member 2, SRECRP-1, Scavenger receptor expressed by endothelial cells 2 protein) (MaxLight 550)

Ask
View Details
AKR7L (Aflatoxin B1 Aldehyde Reductase Member 4, 1, AFB1 Aldehyde Reductase 3, AFB1-AR 3, Aldoketoreductase 7-like, AKR7L, AFAR3, AKR7A4) (HRP)
MBS6454142-01 0.2 mL

AKR7L (Aflatoxin B1 Aldehyde Reductase Member 4, 1, AFB1 Aldehyde Reductase 3, AFB1-AR 3, Aldoketoreductase 7-like, AKR7L, AFAR3, AKR7A4) (HRP)

Ask
View Details
AKR7L (Aflatoxin B1 Aldehyde Reductase Member 4, 1, AFB1 Aldehyde Reductase 3, AFB1-AR 3, Aldoketoreductase 7-like, AKR7L, AFAR3, AKR7A4) (HRP)
MBS6454142-02 5x 0.2 mL

AKR7L (Aflatoxin B1 Aldehyde Reductase Member 4, 1, AFB1 Aldehyde Reductase 3, AFB1-AR 3, Aldoketoreductase 7-like, AKR7L, AFAR3, AKR7A4) (HRP)

Ask
View Details
Chn2 (NM_023543) Mouse Tagged Lenti ORF Clone
MR204906L4 10 µg

Chn2 (NM_023543) Mouse Tagged Lenti ORF Clone

Ask
View Details