Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1β Rabbit pAb (APR18345N)

Product Specifications

Background

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE) . This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IL1β Rabbit pAb (APR18345N) .

Synonyms

IL-1; IL1-BETA; IL1F2; IL1 beta; IL1B

Gene ID

3553

UniProt

P01584

Cellular Locus

Cytoplasm, Cytoplasmic vesicle, Lysosome, Secreted, autophagosome, cytosol, exosome

Applications

WB (Mouse embryonal fibroblast cell, HUVEC cells, Human corneal epithelial cells, Human cells, Homo sapiens, Mus musculus, Sus scrofa, Rattus norvegicus, Bos taurus, Escherichia coli) IHC (Mus musculus) IF (Mus musculus, Homo sapiens) IP (Homo sapiens, Mus musculus) ELISA (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 30kDa Observed MW: 17KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3553

Uniprot URL

https://www.uniprot.org/uniprot/P01584

AA Sequence

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ozagrel
A4344-5.1 10 mM (in 1mL DMSO)

Ozagrel

Sign In for Pricing
View Details
Spry4 3'UTR GFP Stable Cell Line
TU271129 1.0 mL

Spry4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GTF2A1, CT (GTF2A1, TF2A1, Transcription initiation factor IIA subunit 1, General transcription factor IIA subunit 1, TFIIAL, Transcription initiation factor TFIIA 42kD subunit, Transcription initiation factor IIA alpha chain, TFIIA p35 subunit, Transcription initiation factor IIA beta chain, TFIIA p19 subunit) (Biotin) discontinued
036351-Biotin 200 µL

GTF2A1, CT (GTF2A1, TF2A1, Transcription initiation factor IIA subunit 1, General transcription factor IIA subunit 1, TFIIAL, Transcription initiation factor TFIIA 42kD subunit, Transcription initiation factor IIA alpha chain, TFIIA p35 subunit, Transcription initiation factor IIA beta chain, TFIIA p19 subunit) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Slc25a21 Pre-designed siRNA Set B
SI113088B 1 Each

Mouse Slc25a21 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Polyclonal SLP-2 Antibody [HRP]
NBP2-98494H 0.1 mL

Rabbit Polyclonal SLP-2 Antibody [HRP]

Sign In for Pricing
View Details
IL 33 Rat, His
OM296556-01 20 µg

IL 33 Rat, His

Sign In for Pricing
View Details