Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYT1 Rabbit pAb (APR18289N)

Product Specifications

Background

The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MYT1 Rabbit pAb (APR18287N4) .

Synonyms

MYT1; C20orf36; MTF1; MYTI; NZF2; PLPB1; ZC2H2C1; ZC2HC4A

Gene ID

4661

UniProt

Q01538

Cellular Locus

Nucleus

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 122kDa/125kDa Observed MW: 122kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4661

Uniprot URL

https://www.uniprot.org/uniprot/Q01538

AA Sequence

KPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPSSSSCSSSPGVKSPDASQRHSSTSAPSSSMTSPQSSQASRQDEWDRPLDYTKPSRLREEEPEESEPAAHSFASSEADDQEVSEENFEERKYPGEVTLTNFKLKFLSKDIKKELLTCPTPGCDGSGHITGNYASHRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pET28b-T7-6×His-GST-EGFP-6×His Plasmid
PVT47751 2 µg

pET28b-T7-6×His-GST-EGFP-6×His Plasmid

Sign In for Pricing
View Details
Goose Gamma-Aminobutyric Acid Receptor Subunit Rho-2 (GABRR2) ELISA Kit
MBS9375821 Inquire

Goose Gamma-Aminobutyric Acid Receptor Subunit Rho-2 (GABRR2) ELISA Kit

Sign In for Pricing
View Details
Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM
MBS6212099-01 0.1 mL

Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM

Sign In for Pricing
View Details
Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM
MBS6212099-02 5x 0.1 mL

Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM

Sign In for Pricing
View Details
Lupus La protein (SSB) Rat ELISA Kit
E7572 96 Tests

Lupus La protein (SSB) Rat ELISA Kit

Sign In for Pricing
View Details
MCM3 antibody
FNab05058 100 µg

MCM3 antibody

Sign In for Pricing
View Details