Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTF4 Rabbit pAb (APR18282N)

Product Specifications

Background

This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brain-derived neurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF5-deficient mice only show minor cellular deficits and develop normally to adulthood.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NTF4 Rabbit pAb (APR18282N) .

Synonyms

NTF4; GLC10; GLC1O; NT-4; NT-4/5; NT-5; NT4; NT5; NTF5

Gene ID

4909

UniProt

P34130

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: 22KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4909

Uniprot URL

https://www.uniprot.org/uniprot/P34130

AA Sequence

QPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 5HT1F full length protein-synthetic nanodisc
MBS189916-01 0.01 mg

Human 5HT1F full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human 5HT1F full length protein-synthetic nanodisc
MBS189916-02 0.05 mg

Human 5HT1F full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human 5HT1F full length protein-synthetic nanodisc
MBS189916-03 0.1 mg

Human 5HT1F full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Mouse Cytochrome P450 2C37 (CYP2C37) ELISA Kit
abx508203 96 Tests

Mouse Cytochrome P450 2C37 (CYP2C37) ELISA Kit

Sign In for Pricing
View Details
ZNF516 ORF Vector (Human) (pORF)
ORF036280 1.0 µg DNA

ZNF516 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CKB Antibody
OACD00337-100UL 100 µL

CKB Antibody

Sign In for Pricing
View Details