Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC24C Rabbit pAb (APR18276N)

Product Specifications

Background

The protein encoded by this gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The product of this gene may play a role in shaping the vesicle, as well as in cargo selection and concentration. Alternatively spliced transcript variants encoding the same protein have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SEC24C Rabbit pAb (APR18276N) .

Synonyms

SEC24C

Gene ID

9632

UniProt

P53992

Cellular Locus

Cytoplasm, Endoplasmic reticulum membrane, Golgi apparatus membrane, perinuclear region

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 38kDa/118kDa Observed MW: 118kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9632

Uniprot URL

https://www.uniprot.org/uniprot/P53992

AA Sequence

DVLQPGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVESTTEPPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRSRYMKLTVVKQEDKMEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bbs12 Mouse shRNA Plasmid (Locus ID 241950)
TR513438 1 Kit

Bbs12 Mouse shRNA Plasmid (Locus ID 241950)

Sign In for Pricing
View Details
Dusp10 (NM_022019) Mouse Tagged ORF Clone Lentiviral Particle
MR207734L4V 200 µL

Dusp10 (NM_022019) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MYH7B ELISA Kit (Human)
OKCD00629-96W 96 Well

MYH7B ELISA Kit (Human)

Sign In for Pricing
View Details
Mouse Monoclonal N-Cadherin Antibody (rCDH2/8291) [Alexa Fluor 405]
NBP3-23991AF405 0.1 mL

Mouse Monoclonal N-Cadherin Antibody (rCDH2/8291) [Alexa Fluor 405]

Sign In for Pricing
View Details
OR4F5, NT (OR4F5, Olfactory receptor 4F5)
039396 200 µL

OR4F5, NT (OR4F5, Olfactory receptor 4F5)

Sign In for Pricing
View Details
Fadraciclib (CYC065)
C12643-100mg 100 mg

Fadraciclib (CYC065)

Sign In for Pricing
View Details