Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAPTM4B Rabbit pAb (APR18262N)

Product Specifications

Background

Required for optimal lysosomal function. Blocks EGF-stimulated EGFR intraluminal sorting and degradation. Conversely by binding with the phosphatidylinositol 4,5-bisphosphate, regulates its PIP5K1C interaction, inhibits HGS ubiquitination and relieves LAPTM4B inhibition of EGFR degradation. Recruits SLC3A2 and SLC7A5 (the Leu transporter to the lysosome, promoting entry of leucine and other essential amino acid (EAA into the lysosome, stimulating activation of proton-transporting vacuolar (V-ATPase protein pump (V-ATPase and hence mTORC1 activation. Plays a role as negative regulator of TGFB1 production in regulatory T cells. Binds ceramide and facilitates its exit from late endosome in order to control cell death pathways.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LAPTM4B Rabbit pAb (APR18261N1) .

Synonyms

LAPTM4B; LAPTM4beta; LC27

Gene ID

55353

UniProt

Q86VI4

Cellular Locus

Endomembrane system, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/35kDa/41kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55353

Uniprot URL

https://www.uniprot.org/uniprot/Q86VI4

AA Sequence

NSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATVNGAAKEPPPPYVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp90 (PT0053R) PT® Rabbit mAb
YM8479-01 40 µL

Hsp90 (PT0053R) PT® Rabbit mAb

Sign In for Pricing
View Details
Hsp90 (PT0053R) PT® Rabbit mAb
YM8479-02 100 μL

Hsp90 (PT0053R) PT® Rabbit mAb

Sign In for Pricing
View Details
Hsp90 (PT0053R) PT® Rabbit mAb
YM8479-03 200 μL

Hsp90 (PT0053R) PT® Rabbit mAb

Sign In for Pricing
View Details
Rat FAP Ready-To-Use IHC Kit
IHC0475R 50 Tests

Rat FAP Ready-To-Use IHC Kit

Sign In for Pricing
View Details
SEC14L1 Antibody - N-terminal region : FITC (ARP65502_P050-FITC)
ARP65502_P050-FITC 100 µL

SEC14L1 Antibody - N-terminal region : FITC (ARP65502_P050-FITC)

Sign In for Pricing
View Details
Olr336 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7471203 1.0 µg DNA

Olr336 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details