Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSRP1 Rabbit pAb (APR18247N)

Product Specifications

Background

This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CSRP1 Rabbit pAb (APR18247N) .

Synonyms

CSRP1; CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141; HEL-S-286

Gene ID

1465

UniProt

P21291

Cellular Locus

Nucleus

Applications

WB (A172)

Dilution

WB 1:500 - 1:2000 IP 1:50 - 1:200 RIP 1:20 - 1:50

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa Observed MW: 21kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1465

Uniprot URL

https://www.uniprot.org/uniprot/P21291

AA Sequence

MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)
MBS2146939-01 0.1 mL

APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)
MBS2146939-02 0.2 mL

APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)
MBS2146939-03 0.5 mL

APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)
MBS2146939-04 1 mL

APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)
MBS2146939-05 5 mL

APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)
MBS2146939-06 5x 5 mL

APC-Linked Monoclonal Antibody to Cytochrome P450 Reductase (CPR)

Sign In for Pricing
View Details