Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcineurin A Rabbit pAb (APR18223N)

Product Specifications

Background

Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca (2+-mediated signals. Many of the substrates contain a PxIxIT motif and/or a LxVP motif. In response to increased Ca (2+ levels, dephosphorylates and activates phosphatase SSH1 which results in cofilin dephosphorylation. In response to increased Ca (2+ levels following mitochondrial depolarization, dephosphorylates DNM1L inducing DNM1L translocation to the mitochondrion. Dephosphorylates heat shock protein HSPB1 (By similarity. Dephosphorylates and activates transcription factor NFATC1. In response to increased Ca (2+ levels, regulates NFAT-mediated transcription probably by dephosphorylating NFAT and promoting its nuclear translocation. Dephosphorylates and inactivates transcription factor ELK1. Dephosphorylates DARPP32. May dephosphorylate CRTC2 at 'Ser-171' resulting in CRTC2 dissociation from 14-3-3 proteins. Dephosphorylates transcription factor TFEB at 'Ser-211' following Coxsackievirus B3 infection, promoting nuclear translocation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Calcineurin A Rabbit pAb (APR18223N) .

Synonyms

PPP3CA; CALN; CALNA; CALNA1; CCN1; CNA1; PPP2B

Gene ID

5530

UniProt

Q08209

Cellular Locus

Cell membrane, Nucleus, sarcolemma

Applications

WB (, Mus musculus) IP (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/51kDa/52kDa/57kDa/58kDa Observed MW: 57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5530

Uniprot URL

https://www.uniprot.org/uniprot/Q08209

AA Sequence

MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (PE)
MBS6370385-01 0.1 mL

ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (PE)

Sign In for Pricing
View Details
ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (PE)
MBS6370385-02 5x 0.1 mL

ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (PE)

Sign In for Pricing
View Details
PAI-1 mutant reports vitronectin binding
MBS480692-01 0.5 mg

PAI-1 mutant reports vitronectin binding

Sign In for Pricing
View Details
PAI-1 mutant reports vitronectin binding
MBS480692-02 5x 0.5 mg

PAI-1 mutant reports vitronectin binding

Sign In for Pricing
View Details
Cul4a 3'UTR Luciferase Stable Cell Line
TU202967 1.0 mL

Cul4a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ENO1 Antibody, Biotin conjugated
A37094-50UG 50 µg

ENO1 Antibody, Biotin conjugated

Sign In for Pricing
View Details