Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMURF2 Rabbit pAb (APR18207N)

Product Specifications

Background

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD7 to trigger SMAD7-mediated transforming growth factor beta/TGF-beta receptor ubiquitin-dependent degradation, thereby downregulating TGF-beta signaling. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with AIMP1. Also forms a stable complex with TGF-beta receptor-mediated phosphorylated SMAD1, SMAD2 and SMAD3, and targets SMAD1 and SMAD2 for ubiquitination and proteasome-mediated degradation. SMAD2 may recruit substrates, such as SNON, for ubiquitin-dependent degradation. Negatively regulates TGFB1-induced epithelial-mesenchymal transition and myofibroblast differentiation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SMURF2 Rabbit pAb (APR18207N) .

Synonyms

SMURF2

Gene ID

64750

UniProt

Q9HAU4

Cellular Locus

Cell membrane, Cytoplasm, Membrane raft, Nucleus

Applications

IHC (Homo sapiens)

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 86kDa Observed MW: 86kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64750

Uniprot URL

https://www.uniprot.org/uniprot/Q9HAU4

AA Sequence

DCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD8 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-9365R-BF405 100 µL

PSMD8 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Human Monoclonal CXC-ELR Antibody (Lilly patent anti-Pan-ELR+) [mFluor Violet 610 SE]
NBP3-28036MFV610 0.1 mL

Human Monoclonal CXC-ELR Antibody (Lilly patent anti-Pan-ELR+) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Obestatin (Appetite-regulating Hormone, Growth Hormone Secretagogue, Growth Hormone-releasing Peptide, Motilin-related Peptide, Protein M46, Ghrelin, GHRL, MTLRP, UNQ524/PRO1066)
O4802-20C 100 µg

Obestatin (Appetite-regulating Hormone, Growth Hormone Secretagogue, Growth Hormone-releasing Peptide, Motilin-related Peptide, Protein M46, Ghrelin, GHRL, MTLRP, UNQ524/PRO1066)

Sign In for Pricing
View Details
IL22 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
24864124 3x 1.0µg DNA

IL22 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
CD2 Antibody
MBS5313031-01 0.1 mg

CD2 Antibody

Sign In for Pricing
View Details
CD2 Antibody
MBS5313031-02 5x 0.1 mg

CD2 Antibody

Sign In for Pricing
View Details