Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGAT5 Rabbit pAb (APR18181N)

Product Specifications

Background

The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated with the progression of invasive malignancies.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MGAT5 Rabbit pAb (APR18181N) .

Synonyms

MGAT5; GNT-V; GNT-VA; alpha-1

Gene ID

4249

UniProt

Q09328

Cellular Locus

Golgi apparatus membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 84kDa Observed MW: 115kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4249

Uniprot URL

https://www.uniprot.org/uniprot/Q09328

AA Sequence

HGQVMWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCN2 Polyclonal Antibody
A66326-100 100 µL

UCN2 Polyclonal Antibody

Sign In for Pricing
View Details
Vmn1r54 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3105902 1.0 µg DNA

Vmn1r54 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Porcine Prothrombin Fragment 1+2 (F1+2) ELISA Kit
GTR10432032-01 48 Well

Porcine Prothrombin Fragment 1+2 (F1+2) ELISA Kit

Sign In for Pricing
View Details
Porcine Prothrombin Fragment 1+2 (F1+2) ELISA Kit
GTR10432032-02 96 Well

Porcine Prothrombin Fragment 1+2 (F1+2) ELISA Kit

Sign In for Pricing
View Details
KLF1 (Kruppel-like Factor 1 (erythroid), EKLF) (HRP)
247944-HRP 100 µL

KLF1 (Kruppel-like Factor 1 (erythroid), EKLF) (HRP)

Sign In for Pricing
View Details
C1QTNF6 Antibody
DF14540-01 100 µL

C1QTNF6 Antibody

Sign In for Pricing
View Details