Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLOD3 Rabbit pAb (APR18161N)

Product Specifications

Background

The protein encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PLOD3 Rabbit pAb (APR18161N) .

Synonyms

PLOD3; LH3

Gene ID

8985

UniProt

O60568

Cellular Locus

Lumenal side, Peripheral membrane protein, Rough endoplasmic reticulum membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 84kDa Observed MW: 85KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8985

Uniprot URL

https://www.uniprot.org/uniprot/O60568

AA Sequence

SDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSAESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal UBAP1 Antibody [DyLight 594]
NBP2-98559DL594 0.1 mL

Rabbit Polyclonal UBAP1 Antibody [DyLight 594]

Sign In for Pricing
View Details
TAF7, CT (TAF7, TAF2F, TAFII55, Transcription initiation factor TFIID subunit 7, RNA polymerase II TBP-associated factor subunit F, Transcription initiation factor TFIID 55kD subunit) (MaxLight 650) discontinued
042584-ML650 100 µL

TAF7, CT (TAF7, TAF2F, TAFII55, Transcription initiation factor TFIID subunit 7, RNA polymerase II TBP-associated factor subunit F, Transcription initiation factor TFIID 55kD subunit) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Cystathionase Blocking Peptide
33R-9734 0.1 mg

Cystathionase Blocking Peptide

Sign In for Pricing
View Details
Selectin P Ligand Protein
abx263404-01 2 µg

Selectin P Ligand Protein

Sign In for Pricing
View Details
Selectin P Ligand Protein
abx263404-02 10 µg

Selectin P Ligand Protein

Sign In for Pricing
View Details
Selectin P Ligand Protein
abx263404-03 100 µg

Selectin P Ligand Protein

Sign In for Pricing
View Details