Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX7 Rabbit pAb (APR18137N)

Product Specifications

Background

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants have been identified, most of which fit nonsense-mediated decay (NMD) criteria.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality P2RX7 Rabbit pAb (APR18135N1) .

Synonyms

P2RX7; P2X7

Gene ID

5027

UniProt

Q99572

Cellular Locus

Cell membrane, Multi-pass membrane protein

Applications

WB (Mus musculus, Rattus norvegicus, Gallus gallus) IHC (Gallus gallus)

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/31kDa/35kDa/41kDa/49kDa/58kDa/68kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5027

Uniprot URL

https://www.uniprot.org/uniprot/Q99572

AA Sequence

SDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BRUNOL6, NT (CELF6, BRUNOL6, CUGBP Elav-like family member 6, Bruno-like protein 6, CUG-BP-and ETR-3-like factor 6, RNA-binding protein BRUNOL-6) (MaxLight 550)
MBS6279029-01 0.1 mL

BRUNOL6, NT (CELF6, BRUNOL6, CUGBP Elav-like family member 6, Bruno-like protein 6, CUG-BP-and ETR-3-like factor 6, RNA-binding protein BRUNOL-6) (MaxLight 550)

Ask
View Details
BRUNOL6, NT (CELF6, BRUNOL6, CUGBP Elav-like family member 6, Bruno-like protein 6, CUG-BP-and ETR-3-like factor 6, RNA-binding protein BRUNOL-6) (MaxLight 550)
MBS6279029-02 5x 0.1 mL

BRUNOL6, NT (CELF6, BRUNOL6, CUGBP Elav-like family member 6, Bruno-like protein 6, CUG-BP-and ETR-3-like factor 6, RNA-binding protein BRUNOL-6) (MaxLight 550)

Ask
View Details
FRK, NT (Tyrosine-protein Kinase FRK, Nuclear Tyrosine Protein Kinase RAK, FYN-related Kinase, Protein-tyrosine Kinase 5, PTK5, RAK) (AP)
MBS6476963-01 0.2 mL

FRK, NT (Tyrosine-protein Kinase FRK, Nuclear Tyrosine Protein Kinase RAK, FYN-related Kinase, Protein-tyrosine Kinase 5, PTK5, RAK) (AP)

Ask
View Details
FRK, NT (Tyrosine-protein Kinase FRK, Nuclear Tyrosine Protein Kinase RAK, FYN-related Kinase, Protein-tyrosine Kinase 5, PTK5, RAK) (AP)
MBS6476963-02 5x 0.2 mL

FRK, NT (Tyrosine-protein Kinase FRK, Nuclear Tyrosine Protein Kinase RAK, FYN-related Kinase, Protein-tyrosine Kinase 5, PTK5, RAK) (AP)

Ask
View Details
Dry Bath (Large Module Heating Type)
SMB-HH 1 Piece

Dry Bath (Large Module Heating Type)

Ask
View Details
IRAK2 Over-expression Lysate Product
GWB-62BB41 0.1 mg

IRAK2 Over-expression Lysate Product

Ask
View Details