Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT5 Rabbit pAb (APR18118N)

Product Specifications

Background

This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NUDT5 Rabbit pAb (APR18118N) .

Synonyms

NUDT5; YSA1; YSA1H; YSAH1; hNUDT5

Gene ID

11164

UniProt

Q9UKK9

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11164

Uniprot URL

https://www.uniprot.org/uniprot/Q9UKK9

AA Sequence

MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GC Column, H1-1, 30m*0.25mm*0.5μm, 1pc/pk
14011017 1 PC

GC Column, H1-1, 30m*0.25mm*0.5μm, 1pc/pk

Sign In for Pricing
View Details
SLC39A11 (Zinc Transporter ZIP11, Solute Carrier Family 39 (Metal Ion Transporter), Member 11)
492093 100 µL

SLC39A11 (Zinc Transporter ZIP11, Solute Carrier Family 39 (Metal Ion Transporter), Member 11)

Sign In for Pricing
View Details
Rat Cysteine Rich Transmembrane BMP Regulator 1 ELISA Kit
MBS090234-01 48 Well

Rat Cysteine Rich Transmembrane BMP Regulator 1 ELISA Kit

Sign In for Pricing
View Details
Rat Cysteine Rich Transmembrane BMP Regulator 1 ELISA Kit
MBS090234-02 96 Well

Rat Cysteine Rich Transmembrane BMP Regulator 1 ELISA Kit

Sign In for Pricing
View Details
Rat Cysteine Rich Transmembrane BMP Regulator 1 ELISA Kit
MBS090234-03 5x 96 Well

Rat Cysteine Rich Transmembrane BMP Regulator 1 ELISA Kit

Sign In for Pricing
View Details
Rat Cysteine Rich Transmembrane BMP Regulator 1 ELISA Kit
MBS090234-04 10x 96 Well

Rat Cysteine Rich Transmembrane BMP Regulator 1 ELISA Kit

Sign In for Pricing
View Details