Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPB1 Rabbit pAb (APR18110N)

Product Specifications

Background

This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COPB1 Rabbit pAb (APR18110N) .

Synonyms

COPB1; COPB

Gene ID

1315

UniProt

P53618

Cellular Locus

COPI-coated vesicle membrane, Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum-Golgi intermediate compartment, Golgi apparatus membrane, Peripheral membrane protein

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 107kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1315

Uniprot URL

https://www.uniprot.org/uniprot/P53618

AA Sequence

WILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIKKEAGELKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEDRPPLRGFLLDGDFFVAASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYVHVNQYDIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDLIM2 Antibody, HRP conjugated
A66012-100UG 100 µg

PDLIM2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Goat anti-TBP /Transcription factor IID (aa39-50) Antibody
dAP-2614 50 µg

Goat anti-TBP /Transcription factor IID (aa39-50) Antibody

Sign In for Pricing
View Details
Mouse monoclonal ERBB3 antibody
MBS5306014-01 0.1 mL

Mouse monoclonal ERBB3 antibody

Sign In for Pricing
View Details
Mouse monoclonal ERBB3 antibody
MBS5306014-02 5x 0.1 mL

Mouse monoclonal ERBB3 antibody

Sign In for Pricing
View Details
CRTC2 Recombinant Protein (Rat)
RP196370 100 µg

CRTC2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Rwdd2b (NM_016924) Mouse Untagged Clone
MC200314 10 µg

Rwdd2b (NM_016924) Mouse Untagged Clone

Sign In for Pricing
View Details