Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSF Rabbit pAb (APR18094N)

Product Specifications

Background

Cathepsins are papain family cysteine proteinases that represent a major component of the lysosomal proteolytic system. Cathepsins generally contain a signal sequence, followed by a propeptide and then a catalytically active mature region. The very long (251 amino acid residues) proregion of the cathepsin F precursor contains a C-terminal domain similar to the pro-segment of cathepsin L-like enzymes, a 50-residue flexible linker peptide, and an N-terminal domain predicted to adopt a cystatin-like fold. The cathepsin F proregion is unique within the papain family cysteine proteases in that it contains this additional N-terminal segment predicted to share structural similarities with cysteine protease inhibitors of the cystatin superfamily. This cystatin-like domain contains some of the elements known to be important for inhibitory activity. CTSF encodes a predicted protein of 484 amino acids which contains a 19 residue signal peptide. Cathepsin F contains five potential N-glycosylation sites, and it may be targeted to the endosomal/lysosomal compartment via the mannose 6-phosphate receptor pathway. The cathepsin F gene is ubiquitously expressed, and it maps to chromosome 11q13, close to the gene encoding cathepsin W.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CTSF Rabbit pAb (APR18094N) .

Synonyms

CTSF; CATSF; CLN13

Gene ID

8722

UniProt

Q9UBX1

Cellular Locus

Lysosome

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa Observed MW: 53kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8722

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBX1

AA Sequence

LAPPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pack of 100 Sheets of Creped Filter Paper, 200X200 Mm
ST64F2020C Pack of 100

Pack of 100 Sheets of Creped Filter Paper, 200X200 Mm

Sign In for Pricing
View Details
Beta-galactosidase Antibody [13R4], Mouse Fab fragment
24-140 0.2 mg

Beta-galactosidase Antibody [13R4], Mouse Fab fragment

Sign In for Pricing
View Details
TBR1 Recombinant Antibody, FITC Conjugated
bsm-60877R-FITC-01 20 µL

TBR1 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
TBR1 Recombinant Antibody, FITC Conjugated
bsm-60877R-FITC-02 100 µL

TBR1 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
NT5C3L Adenovirus (Human)
32223052 1.0 mL

NT5C3L Adenovirus (Human)

Sign In for Pricing
View Details
Lentiviral human ANKDD1A shRNA (UAS) - Lentiviral human ANKDD1A shRNA (UAS) plasmid
GTR15313966 1 Vial

Lentiviral human ANKDD1A shRNA (UAS) - Lentiviral human ANKDD1A shRNA (UAS) plasmid

Sign In for Pricing
View Details