Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEFF2 Rabbit pAb (APR18089N)

Product Specifications

Background

This gene encodes a member of the tomoregulin family of transmembrane proteins. This protein has been shown to function as both an oncogene and a tumor suppressor depending on the cellular context and may regulate prostate cancer cell invasion. Multiple soluble forms of this protein have been identified that arise from both an alternative splice variant and ectodomain shedding. Additionally, this gene has been found to be hypermethylated in multiple cancer types. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TMEFF2 Rabbit pAb (APR18089N) .

Synonyms

TMEFF2; CT120.2; HPP1; TENB2; TPEF; TR; TR-2

Gene ID

23671

UniProt

Q9UIK5

Cellular Locus

Membrane, Secreted, Single-pass type I membrane protein, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/38kDa/41kDa Observed MW: 41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23671

Uniprot URL

https://www.uniprot.org/uniprot/Q9UIK5

AA Sequence

FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fbxo17 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6558003 1.0 µg DNA

Fbxo17 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
GNB2 Antibody
ABD7783 100 µg

GNB2 Antibody

Sign In for Pricing
View Details
HEPACAM2 Recombinant Protein
32-3949-10 10 µg

HEPACAM2 Recombinant Protein

Sign In for Pricing
View Details
Human Xeroderma Pigmentosum, XPC ELISA Kit
MBS1608883-01 48 Well

Human Xeroderma Pigmentosum, XPC ELISA Kit

Sign In for Pricing
View Details
Human Xeroderma Pigmentosum, XPC ELISA Kit
MBS1608883-02 96 Well

Human Xeroderma Pigmentosum, XPC ELISA Kit

Sign In for Pricing
View Details
Human Xeroderma Pigmentosum, XPC ELISA Kit
MBS1608883-03 5x 96 Well

Human Xeroderma Pigmentosum, XPC ELISA Kit

Sign In for Pricing
View Details