Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFWD2 Rabbit pAb (APR18088N)

Product Specifications

Background

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53 ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival. Ubiquitinates MTA1 leading to its proteasomal degradation. Upon binding to TRIB1, ubiquitinates CEBPA, which lacks a canonical COP1-binding motif (Probable.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RFWD2 Rabbit pAb (APR18084N3) .

Synonyms

RFWD2; COP1; RNF200

Gene ID

64326

UniProt

Q8NHY2

Cellular Locus

Cytoplasm, Nucleus speckle

Applications

WB (Rattus norvegicus) IF (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/57kDa/77kDa/78kDa/80kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64326

Uniprot URL

https://www.uniprot.org/uniprot/Q8NHY2

AA Sequence

YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKCI Human Pre-designed siRNA Set A
HY-RS11134 1 Set

PRKCI Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Reagecon Cobaltous Chloride Standard Solution according to Chinese Pharmacopoeia (ChP)
CPPR01 100 mL

Reagecon Cobaltous Chloride Standard Solution according to Chinese Pharmacopoeia (ChP)

Sign In for Pricing
View Details
IRGQ Rabbit Polyclonal Antibody (FITC)
orb188702 100 µL

IRGQ Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal NPAS3 Antibody [DyLight 550]
NBP1-76785R 0.1 mL

Rabbit Polyclonal NPAS3 Antibody [DyLight 550]

Sign In for Pricing
View Details
Human GPR37 Alexa Fluor 700 Antibody (Clone 436923)
IC4450N-100UG 100 µg

Human GPR37 Alexa Fluor 700 Antibody (Clone 436923)

Sign In for Pricing
View Details
Butyryl-Histone H2B (Lys23) Mouse mAb
E47M60188 100 µL

Butyryl-Histone H2B (Lys23) Mouse mAb

Sign In for Pricing
View Details