Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC2 Rabbit pAb (APR18074N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EXOSC2 Rabbit pAb (APR18073N0) .

Synonyms

EXOSC2; RRP4; Rrp4p; hRrp4p; p7

Gene ID

23404

UniProt

Q13868

Cellular Locus

Cytoplasm, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/30kDa/32kDa Observed MW: 33kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23404

Uniprot URL

https://www.uniprot.org/uniprot/Q13868

AA Sequence

MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SET Rabbit Polyclonal Antibody (HRP)
orb2103194 100 µL

SET Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human TNFRSF4 Protein, His Tag
E40KMPH2133 20 µg

Human TNFRSF4 Protein, His Tag

Sign In for Pricing
View Details
Goat Anti-Mouse Ig, Human ads-TXRD
1010-07 1 mg

Goat Anti-Mouse Ig, Human ads-TXRD

Sign In for Pricing
View Details
5 Lipoxygenase (ALOX5) (NM_000698) Human Tagged Lenti ORF Clone
RC217259L2 10 µg

5 Lipoxygenase (ALOX5) (NM_000698) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LYZL1 Rabbit pAb, PerCP-Cy7 conjugated
orb2881905 100 µL

LYZL1 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Lentiviral mouse Snrpa1 shRNA (UAS) - Lentiviral mouseSnrpa1 shRNA (UAS, GFP) (25)
GTR15103820 1 Vial

Lentiviral mouse Snrpa1 shRNA (UAS) - Lentiviral mouseSnrpa1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details