Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNA14 Rabbit pAb (APR18030N)

Product Specifications

Background

This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GNA14 Rabbit pAb (APR18030N) .

Synonyms

GNA14

Gene ID

9630

UniProt

O95837

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa Observed MW: 41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9630

Uniprot URL

https://www.uniprot.org/uniprot/O95837

AA Sequence

LLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TNS4 Antibody
A60901-100UL 100 µL

TNS4 Antibody

Ask
View Details
Mouse Monoclonal OVOL2 Antibody (PCRP-OVOL2-2A1) [DyLight 350]
NBP3-08926UV 100 µL

Mouse Monoclonal OVOL2 Antibody (PCRP-OVOL2-2A1) [DyLight 350]

Ask
View Details
AUTS2 (NM_001127232) Human Tagged ORF Clone
RC225360 10 µg

AUTS2 (NM_001127232) Human Tagged ORF Clone

Ask
View Details
Aldo-keto Reductase Family 1 Member C1, Recombinant, Human (AKR1C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, 2-alpha-HSD, C9, Chlordecone Reductase Homolog HAKRC, Indanol Dehydrogenase, Dihydrodiol Dehydrogenase 1/2, DD1, DD1/DD2, DDH, DDH1, H-37, HAKRC, High-affinity Hepatic Bile Acid-binding Protein, HBAB, MBAB, MGC8954, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase)
A1334-70L-01 20 µg

Aldo-keto Reductase Family 1 Member C1, Recombinant, Human (AKR1C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, 2-alpha-HSD, C9, Chlordecone Reductase Homolog HAKRC, Indanol Dehydrogenase, Dihydrodiol Dehydrogenase 1/2, DD1, DD1/DD2, DDH, DDH1, H-37, HAKRC, High-affinity Hepatic Bile Acid-binding Protein, HBAB, MBAB, MGC8954, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase)

Ask
View Details
Aldo-keto Reductase Family 1 Member C1, Recombinant, Human (AKR1C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, 2-alpha-HSD, C9, Chlordecone Reductase Homolog HAKRC, Indanol Dehydrogenase, Dihydrodiol Dehydrogenase 1/2, DD1, DD1/DD2, DDH, DDH1, H-37, HAKRC, High-affinity Hepatic Bile Acid-binding Protein, HBAB, MBAB, MGC8954, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase)
A1334-70L-02 100 µg

Aldo-keto Reductase Family 1 Member C1, Recombinant, Human (AKR1C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, 2-alpha-HSD, C9, Chlordecone Reductase Homolog HAKRC, Indanol Dehydrogenase, Dihydrodiol Dehydrogenase 1/2, DD1, DD1/DD2, DDH, DDH1, H-37, HAKRC, High-affinity Hepatic Bile Acid-binding Protein, HBAB, MBAB, MGC8954, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase)

Ask
View Details
Aldo-keto Reductase Family 1 Member C1, Recombinant, Human (AKR1C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, 2-alpha-HSD, C9, Chlordecone Reductase Homolog HAKRC, Indanol Dehydrogenase, Dihydrodiol Dehydrogenase 1/2, DD1, DD1/DD2, DDH, DDH1, H-37, HAKRC, High-affinity Hepatic Bile Acid-binding Protein, HBAB, MBAB, MGC8954, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase)
A1334-70L-03 500 µg

Aldo-keto Reductase Family 1 Member C1, Recombinant, Human (AKR1C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, 2-alpha-HSD, C9, Chlordecone Reductase Homolog HAKRC, Indanol Dehydrogenase, Dihydrodiol Dehydrogenase 1/2, DD1, DD1/DD2, DDH, DDH1, H-37, HAKRC, High-affinity Hepatic Bile Acid-binding Protein, HBAB, MBAB, MGC8954, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase)

Ask
View Details