Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF21 Rabbit pAb (APR17992N)

Product Specifications

Background

Theis gene encodes a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The encoded protein stimulates the uptake of glucose in adipose tissue.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FGF21 Rabbit pAb (APR17992N) .

Synonyms

FGF21

Gene ID

26291

UniProt

Q9NSA1

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26291

Uniprot URL

https://www.uniprot.org/uniprot/Q9NSA1

AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT74 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV631576 1.0 µg DNA

IFT74 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Monkey Olfactory receptor 2G6 (OR2G6) ELISA kit
GTR10437556 96 Well

Monkey Olfactory receptor 2G6 (OR2G6) ELISA kit

Sign In for Pricing
View Details
ARHGEF10L CRISPRa sgRNA lentivector (set of three targets)(Human)
12321121 3x 1.0µg DNA

ARHGEF10L CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
SAA4 sgRNA CRISPR Lentivector (Human) (Target 3)
K2084904 1.0 µg DNA

SAA4 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
DTX3, NT (DTX3, RNF154, Probable E3 ubiquitin-protein ligase DTX3, Protein deltex-3, RING finger protein 154)
MBS6011149-01 0.2 mL

DTX3, NT (DTX3, RNF154, Probable E3 ubiquitin-protein ligase DTX3, Protein deltex-3, RING finger protein 154)

Sign In for Pricing
View Details
DTX3, NT (DTX3, RNF154, Probable E3 ubiquitin-protein ligase DTX3, Protein deltex-3, RING finger protein 154)
MBS6011149-02 5x 0.2 mL

DTX3, NT (DTX3, RNF154, Probable E3 ubiquitin-protein ligase DTX3, Protein deltex-3, RING finger protein 154)

Sign In for Pricing
View Details