Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIAPH3 Rabbit pAb (APR17976N)

Product Specifications

Background

This gene encodes a member of the diaphanous subfamily of the formin family. Members of this family are involved in actin remodeling and regulate cell movement and adhesion. Mutations in this gene are associated with autosomal dominant auditory neuropathy 1. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DIAPH3 Rabbit pAb (APR17974N1) .

Synonyms

DIAPH3; AN; AUNA1; DIA2; DRF3; NSDAN; diap3; mDia2

Gene ID

81624

UniProt

Q9NSV4

Cellular Locus

Cytoplasm, cytosol

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 79kDa/98kDa/127-136kDa Observed MW: 137kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81624

Uniprot URL

https://www.uniprot.org/uniprot/Q9NSV4

AA Sequence

KYPDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHGNKPYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AA-dUTP [Aminoallyl dUTP sodium salt] *4 mM in TE Buffer (pH 7.5) * *CAS 936327-10-5*
17004-AAT 1 µmole

AA-dUTP [Aminoallyl dUTP sodium salt] *4 mM in TE Buffer (pH 7.5) * *CAS 936327-10-5*

Sign In for Pricing
View Details
P70 S6 Kinase (Ab-229) Antibody
8B0531-AAT 50 µg

P70 S6 Kinase (Ab-229) Antibody

Sign In for Pricing
View Details
C20orf103 (LAMP5) Rabbit Polyclonal Antibody
TA360868 100 µL

C20orf103 (LAMP5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Togni’s Reagent
TRC-T529000-1G 1 g

Togni’s Reagent

Sign In for Pricing
View Details
NEK3 (NM_002498) Human Over-expression Lysate
LY419289 100 µg

NEK3 (NM_002498) Human Over-expression Lysate

Sign In for Pricing
View Details
FSD1 Rabbit Polyclonal Antibody
TA370123 100 µL

FSD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details