Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3MBTL2 Rabbit pAb (APR17956N)

Product Specifications

Background

Putative Polycomb group (PcG protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin-remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis. Binds to monomethylated and dimethylated 'Lys-20' on histone H4. Binds histone H3 peptides that are monomethylated or dimethylated on 'Lys-4', 'Lys-9' or 'Lys-27'.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality L3MBTL2 Rabbit pAb (APR17956N) .

Synonyms

L3MBTL2; H-l (3) mbt-l; L3MBT

Gene ID

83746

UniProt

Q969R5

Cellular Locus

Nucleus

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 69kDa/79kDa Observed MW: 95kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=83746

Uniprot URL

https://www.uniprot.org/uniprot/Q969R5

AA Sequence

PATFCQKNDIELTPPKGYEAQTFNWENYLEKTKSKAAPSRLFNMDCPNHGFKVGMKLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDSEYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQFGKKRKRIPPTKTRPLRQGSKKPLLEDDPQGARKISSEPVPGEIIAVRVKEEHLDVASPDKASSPELPVSVENIKQETDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (LH2), CF740 conjugate, 0.1mg/mL
BNC740674-500 1x 500 µL

Cytokeratin 10 (LH2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2956), CF740 conjugate, 0.1mg/mL
BNC742956-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2956), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF647 conjugate, 0.1mg/mL
BNC471714-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details