Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A6 Rabbit pAb (APR17948N)

Product Specifications

Background

This gene belongs to the solute carrier 26 family, whose members encode anion transporter proteins. This particular family member encodes a protein involved in transporting chloride, oxalate, sulfate and bicarbonate. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC26A6 Rabbit pAb (APR17948N) .

Synonyms

SLC26A6

Gene ID

65010

UniProt

Q9BXS9

Cellular Locus

Apical cell membrane, Basolateral cell membrane, Cell membrane, Cytoplasmic vesicle membrane, Membrane, Microsome, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 73kDa/76kDa/79kDa/80kDa/82kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=65010

Uniprot URL

https://www.uniprot.org/uniprot/Q9BXS9

AA Sequence

QMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGVKVFRSSATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAASPKGASVSINVNTSLEDMRSNNVEDCKMMVSSGDKMEDATANGQEDSKAPDGSTLKALGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGHFFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2Q1 Antibody - middle region : Biotin (ARP62941_P050-Biotin)
ARP62941_P050-Biotin 100 µL

UBE2Q1 Antibody - middle region : Biotin (ARP62941_P050-Biotin)

Sign In for Pricing
View Details
CD1C Knockout HAP1 Polyclonal Cells
ARG43408 1 Million

CD1C Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Human TATA box-binding protein-associated factor RNA polymerase I subunit A (TAF1A)
MBS1455579-01 0.02 mg (E-Coli)

Recombinant Human TATA box-binding protein-associated factor RNA polymerase I subunit A (TAF1A)

Sign In for Pricing
View Details
Recombinant Human TATA box-binding protein-associated factor RNA polymerase I subunit A (TAF1A)
MBS1455579-02 0.02 mg (Yeast)

Recombinant Human TATA box-binding protein-associated factor RNA polymerase I subunit A (TAF1A)

Sign In for Pricing
View Details
Recombinant Human TATA box-binding protein-associated factor RNA polymerase I subunit A (TAF1A)
MBS1455579-03 0.1 mg (E-Coli)

Recombinant Human TATA box-binding protein-associated factor RNA polymerase I subunit A (TAF1A)

Sign In for Pricing
View Details
Recombinant Human TATA box-binding protein-associated factor RNA polymerase I subunit A (TAF1A)
MBS1455579-04 0.1 mg (Yeast)

Recombinant Human TATA box-binding protein-associated factor RNA polymerase I subunit A (TAF1A)

Sign In for Pricing
View Details