Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement C1q subcomponent subunit A (C1qa), Biotinylated

Product Specifications

Abbreviation

Recombinant Mouse C1qa protein, Biotinylated

Gene Name

C1qa

UniProt

P98086

Expression Region

23-245aa

Organism

Mus musculus (Mouse)

Target Sequence

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca (2+) -dependent C1r (2) C1s (2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

71.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRI1 (NM_001031727) Human Mass Spec Standard
PH300993 10 µg

MRI1 (NM_001031727) Human Mass Spec Standard

Sign In for Pricing
View Details
Heat Shock Protein 27 (HSP27, Estrogen-Regulated 24K Protein, HSP28)
H1830-50K-01 50 µL

Heat Shock Protein 27 (HSP27, Estrogen-Regulated 24K Protein, HSP28)

Sign In for Pricing
View Details
Heat Shock Protein 27 (HSP27, Estrogen-Regulated 24K Protein, HSP28)
H1830-50K-02 100 µL

Heat Shock Protein 27 (HSP27, Estrogen-Regulated 24K Protein, HSP28)

Sign In for Pricing
View Details
CCDC56 Polyclonal Antibody, PE-Cy7 Conjugated
bs-8116R-PE-Cy7 100 µL

CCDC56 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse TNFRSF8/CD30L Receptor/CD30 Protein (C-6His)
MBS2553632-01 0.01 mg

Recombinant Mouse TNFRSF8/CD30L Receptor/CD30 Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse TNFRSF8/CD30L Receptor/CD30 Protein (C-6His)
MBS2553632-02 0.05 mg

Recombinant Mouse TNFRSF8/CD30L Receptor/CD30 Protein (C-6His)

Sign In for Pricing
View Details