Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement C1q subcomponent subunit A (C1qa), Biotinylated

Product Specifications

Abbreviation

Recombinant Mouse C1qa protein, Biotinylated

Gene Name

C1qa

UniProt

P98086

Expression Region

23-245aa

Organism

Mus musculus (Mouse)

Target Sequence

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca (2+) -dependent C1r (2) C1s (2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

71.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YebC Antibody
orb831106 2 mg

YebC Antibody

Sign In for Pricing
View Details
SRRM1P3 3'UTR Luciferase Stable Cell Line
TU024624 1.0 mL

SRRM1P3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse EphA6 / EHK-2 Protein (His tag)
ARP5562-01 10 µg

Recombinant Mouse EphA6 / EHK-2 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse EphA6 / EHK-2 Protein (His tag)
ARP5562-02 50 µg

Recombinant Mouse EphA6 / EHK-2 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse EphA6 / EHK-2 Protein (His tag)
ARP5562-03 100 µg

Recombinant Mouse EphA6 / EHK-2 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse EphA6 / EHK-2 Protein (His tag)
ARP5562-04 1 mg

Recombinant Mouse EphA6 / EHK-2 Protein (His tag)

Sign In for Pricing
View Details