Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNG2 Rabbit pAb (APR17933N)

Product Specifications

Background

This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GNG2 Rabbit pAb (APR17933N) .

Synonyms

GNG2

Gene ID

54331

UniProt

P59768

Cellular Locus

Cell membrane, Cytoplasmic side, Lipid-anchor

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 7kDa Observed MW: 8kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54331

Uniprot URL

https://www.uniprot.org/uniprot/P59768

AA Sequence

MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM225B (NM_001195542) AAV Particle
RC236673A1V 250 µL

Human TMEM225B (NM_001195542) AAV Particle

Sign In for Pricing
View Details
ITIH6 (NM_198510) Human Untagged Clone
SC307728 10 µg

ITIH6 (NM_198510) Human Untagged Clone

Sign In for Pricing
View Details
Rat Allograft inflammatory factor 1,AIF1 ELISA KIT
JOT-EK2633Ra-01 96 Well

Rat Allograft inflammatory factor 1,AIF1 ELISA KIT

Sign In for Pricing
View Details
Rat Allograft inflammatory factor 1,AIF1 ELISA KIT
JOT-EK2633Ra-02 48 Well

Rat Allograft inflammatory factor 1,AIF1 ELISA KIT

Sign In for Pricing
View Details
Recombinant Fusobacterium nucleatum subsp.nucleatum 3-aminobutyryl-CoA ammonia lyase (kal)
MBS1317323-01 0.02 mg (E-Coli)

Recombinant Fusobacterium nucleatum subsp.nucleatum 3-aminobutyryl-CoA ammonia lyase (kal)

Sign In for Pricing
View Details
Recombinant Fusobacterium nucleatum subsp.nucleatum 3-aminobutyryl-CoA ammonia lyase (kal)
MBS1317323-02 0.1 mg (E-Coli)

Recombinant Fusobacterium nucleatum subsp.nucleatum 3-aminobutyryl-CoA ammonia lyase (kal)

Sign In for Pricing
View Details