Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTCB Rabbit pAb (APR17929N)

Product Specifications

Background

Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as an RNA ligase with broad substrate specificity, and may function toward other RNAs.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RTCB Rabbit pAb (APR17929N) .

Synonyms

RTCB; C22orf28; DJ149A16.6; FAAP; HSPC117

Gene ID

51493

UniProt

Q9Y3I0

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51493

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y3I0

AA Sequence

EIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Phenylamino Adenosine
TRC-P319530-50MG 50 mg

2-Phenylamino Adenosine

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF640R conjugate, 0.1mg/mL
BNC401540-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gastric Inhibitory Polypeptide Receptor (GIPR) (NM_000164) Human Over-expression Lysate
LC400060 20 µg

Gastric Inhibitory Polypeptide Receptor (GIPR) (NM_000164) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant KAP1 Antibody
RN-12555-01 50 μL

Recombinant KAP1 Antibody

Sign In for Pricing
View Details
Recombinant KAP1 Antibody
RN-12555-02 100 µL

Recombinant KAP1 Antibody

Sign In for Pricing
View Details
Recombinant KAP1 Antibody
RN-12555-03 1 mL

Recombinant KAP1 Antibody

Sign In for Pricing
View Details