Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1 Rabbit pAb (APR17912N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BTN3A1 Rabbit pAb (APR17912N) .

Synonyms

BTN3A1; BT3.1; BTF5; BTN3.1; CD277

Gene ID

+011118-12-31T23:00:00.000Z

UniProt

O00481

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/41kDa/52kDa/57kDa Observed MW: 56kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

+011118-12-31T23:00:00.000Z

Uniprot URL

https://www.uniprot.org/uniprot/O00481

AA Sequence

ILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GIPR Antibody FITC Conjugated
MBS9460593-01 0.1 mL

GIPR Antibody FITC Conjugated

Ask
View Details
GIPR Antibody FITC Conjugated
MBS9460593-02 5x 0.1 mL

GIPR Antibody FITC Conjugated

Ask
View Details
TEPP CRISPRa sgRNA lentivector (set of three targets)(Rat)
46495126 3x 1.0µg DNA

TEPP CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details
Rac-Cotinine-d3 (1.0 mg/mL in Methanol) discontinued
166259 5 mL

Rac-Cotinine-d3 (1.0 mg/mL in Methanol) discontinued

Ask
View Details
MAP Kinase p44/42, phosphorylated (Thr202/Tyr204) (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1, PRKM2 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, p44-ERK1, ERK1, PRKM3) (HRP) discontinued
M2363-HRP 100 µL

MAP Kinase p44/42, phosphorylated (Thr202/Tyr204) (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1, PRKM2 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, p44-ERK1, ERK1, PRKM3) (HRP) discontinued

Ask
View Details
Rabbit anti Sheep IgG-HRP
MBS8503961-01 1 mg

Rabbit anti Sheep IgG-HRP

Ask
View Details