Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNMB2 Rabbit pAb (APR17901N)

Product Specifications

Background

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants of this gene. Additional variants are discussed in the literature, but their full length nature has not been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KCNMB2 Rabbit pAb (APR17901N) .

Synonyms

KCNMB2

Gene ID

10242

UniProt

Q9Y691

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10242

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y691

AA Sequence

TLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPK4 Polyclonal Antibody
E-AB-13568-01 20 µL

RIPK4 Polyclonal Antibody

Sign In for Pricing
View Details
RIPK4 Polyclonal Antibody
E-AB-13568-02 60 µL

RIPK4 Polyclonal Antibody

Sign In for Pricing
View Details
RIPK4 Polyclonal Antibody
E-AB-13568-03 120 µL

RIPK4 Polyclonal Antibody

Sign In for Pricing
View Details
RIPK4 Polyclonal Antibody
E-AB-13568-04 200 µL

RIPK4 Polyclonal Antibody

Sign In for Pricing
View Details
Peroxiredoxin 1 (PRDX1) Human Gene Knockout Kit (CRISPR)
KN205072BN 1 Kit

Peroxiredoxin 1 (PRDX1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ZNF50 (ZSCAN22) activation kit by CRISPRa
GA117555 1 Kit

Human ZNF50 (ZSCAN22) activation kit by CRISPRa

Sign In for Pricing
View Details