Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINPP1 Rabbit pAb (APR17897N)

Product Specifications

Background

This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MINPP1 Rabbit pAb (APR17897N) .

Synonyms

MINPP1; HIPER1; MINPP2; MIPP

Gene ID

9562

UniProt

Q9UNW1

Cellular Locus

Endoplasmic reticulum lumen

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/33kDa/34kDa/55kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9562

Uniprot URL

https://www.uniprot.org/uniprot/Q9UNW1

AA Sequence

KSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Haemophilus ducreyi Na (+)/H (+) antiporter nhaA (nhaA), partial
MBS7089797 Inquire

Recombinant Haemophilus ducreyi Na (+)/H (+) antiporter nhaA (nhaA), partial

Sign In for Pricing
View Details
Zfp13 Rat shRNA Plasmid (Locus ID 287095)
TL704362 1 Kit

Zfp13 Rat shRNA Plasmid (Locus ID 287095)

Sign In for Pricing
View Details
CALN1 Recombinant Protein
OPCD00684-10UG 10 µg

CALN1 Recombinant Protein

Sign In for Pricing
View Details
Macrophage Colony Stimulating Factor (M-CSF, MCSF, Colony Stimulating Factor 1, CSF1, CSF-1, Lanimostim, Macrophage Colony Stimulating Factor 1, MGC31930) (MaxLight 550)
MBS6485744-01 0.1 mL

Macrophage Colony Stimulating Factor (M-CSF, MCSF, Colony Stimulating Factor 1, CSF1, CSF-1, Lanimostim, Macrophage Colony Stimulating Factor 1, MGC31930) (MaxLight 550)

Sign In for Pricing
View Details
Macrophage Colony Stimulating Factor (M-CSF, MCSF, Colony Stimulating Factor 1, CSF1, CSF-1, Lanimostim, Macrophage Colony Stimulating Factor 1, MGC31930) (MaxLight 550)
MBS6485744-02 5x 0.1 mL

Macrophage Colony Stimulating Factor (M-CSF, MCSF, Colony Stimulating Factor 1, CSF1, CSF-1, Lanimostim, Macrophage Colony Stimulating Factor 1, MGC31930) (MaxLight 550)

Sign In for Pricing
View Details
Vasotocin (free acid) [Lys8] peptide
orb233823-01 1 mg

Vasotocin (free acid) [Lys8] peptide

Sign In for Pricing
View Details