Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNA2D2 Rabbit pAb (APR17891N)

Product Specifications

Background

Calcium channels mediate the entry of calcium ions into the cell upon membrane polarization. This gene encodes the alpha-2/delta subunit of the voltage-dependent calcium channel complex. The complex consists of the main channel-forming subunit alpha-1, and auxiliary subunits alpha-2/delta, beta, and gamma. The auxiliary subunits function in the assembly and membrane localization of the complex, and modulate calcium currents and channel activation/inactivation kinetics. The subunit encoded by this gene undergoes post-translational cleavage to yield the extracellular alpha2 peptide and a membrane-anchored delta polypeptide. This subunit is a receptor for the antiepileptic drug, gabapentin. Mutations in this gene are associated with early infantile epileptic encephalopathy. Single nucleotide polymorphisms in this gene are correlated with increased sensitivity to opioid drugs. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CACNA2D2 Rabbit pAb (APR17891N) .

Synonyms

CACNA2D2; CACNA2D

Gene ID

9254

UniProt

Q9NY47

Cellular Locus

Membrane, Single-pass type I membrane protein

Applications

WB (Mus musculus)

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 122kDa/129kDa/130kDa Observed MW: 140-160kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9254

Uniprot URL

https://www.uniprot.org/uniprot/Q9NY47

AA Sequence

RPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGASAYSFPQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SST 3'UTR GFP Stable Cell Line
TU074670 1.0 mL

SST 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Fmoc-Pro TentaGel® R PHB Resin
RA1322.1G 1 g

Fmoc-Pro TentaGel® R PHB Resin

Sign In for Pricing
View Details
TMEM48 Protein Vector (Mouse) (pPB-C-His)
PV239726 500 ng

TMEM48 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal Aurora A/B Antibody (3H1) [Janelia Fluor 549]
NBP2-50043JF549 0.1 mL

Mouse Monoclonal Aurora A/B Antibody (3H1) [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Human CD158b2/KIR2DL3 Protein, C-Fc
EHE43601 100 μg

Recombinant Human CD158b2/KIR2DL3 Protein, C-Fc

Sign In for Pricing
View Details
AP-1 Luciferase Reporter Hela Stable Cell Line
SL-0019 Two Vials: 2x 10^6 Cells

AP-1 Luciferase Reporter Hela Stable Cell Line

Sign In for Pricing
View Details