Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP13 Rabbit pAb (APR17888N)

Product Specifications

Background

Deubiquitinase that mediates deubiquitination of target proteins such as BECN1, MITF, SKP2 and USP10 and is involved in various processes such as autophagy and endoplasmic reticulum-associated degradation (ERAD. Component of a regulatory loop that controls autophagy and p53/TP53 levels: mediates deubiquitination of BECN1, a key regulator of autophagy, leading to stabilize the PIK3C3/VPS34-containing complexes. Also deubiquitinates USP10, an essential regulator of p53/TP53 stability. In turn, PIK3C3/VPS34-containing complexes regulate USP13 stability, suggesting the existence of a regulatory system by which PIK3C3/VPS34-containing complexes regulate p53/TP53 protein levels via USP10 and USP13. Recruited by nuclear UFD1 and mediates deubiquitination of SKP2, thereby regulating endoplasmic reticulum-associated degradation (ERAD. Also regulates ERAD through the deubiquitination of UBL4A a component of the BAG6/BAT3 complex. Mediates stabilization of SIAH2 independently of deubiquitinase activity: binds ubiquitinated SIAH2 and acts by impairing SIAH2 autoubiquitination. Has a weak deubiquitinase activity in vitro and preferentially cleaves 'Lys-63'-linked polyubiquitin chains. In contrast to USP5, it is not able to mediate unanchored polyubiquitin disassembly. Able to cleave ISG15 in vitro; however, additional experiments are required to confirm such data.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality USP13 Rabbit pAb (APR17888N) .

Synonyms

USP13; ISOT3; IsoT-3

Gene ID

8975

UniProt

Q92995

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 90kDa/97kDa Observed MW: 97kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8975

Uniprot URL

https://www.uniprot.org/uniprot/Q92995

AA Sequence

MHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptcd3 ORF Vector (Rat) (pORF)
ORF074255 1.0 µg DNA

Ptcd3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Tlx1 Mouse shRNA Lentiviral Particle (Locus ID 21908)
TL510939V 500 µL Each

Tlx1 Mouse shRNA Lentiviral Particle (Locus ID 21908)

Sign In for Pricing
View Details
Pentacosanoic Acid-d3
TRC-P238192-25MG 25 mg

Pentacosanoic Acid-d3

Sign In for Pricing
View Details
MrgA9 Double Nickase Plasmid (m2)
sc-437150-NIC-2 20 µg

MrgA9 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) katnal1 Polyclonal Antibody
MBS7196786 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) katnal1 Polyclonal Antibody

Sign In for Pricing
View Details
RBM28 Human qPCR Template Standard (NM_018077)
HK206190 1 Kit

RBM28 Human qPCR Template Standard (NM_018077)

Sign In for Pricing
View Details