Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3B Rabbit pAb (APR17883N)

Product Specifications

Background

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3 complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC. The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality eIF3B Rabbit pAb (APR17883N) .

Synonyms

EIF3B; EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1

Gene ID

8662

UniProt

P55884

Cellular Locus

Cytoplasm

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 92kDa/99kDa Observed MW: 125kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8662

Uniprot URL

https://www.uniprot.org/uniprot/P55884

AA Sequence

PVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL13AP5 CRISPR Knock Out 293T Cell Line (Human)
40825141 1x 10^6 Cells / 1.0 mL

RPL13AP5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
NSE (Neuron Specific Enolase) Antibody, Ready-To-Use
MAB372P 7 mL

NSE (Neuron Specific Enolase) Antibody, Ready-To-Use

Sign In for Pricing
View Details
GSK-3β probe-1
HY-172599 1 Each

GSK-3β probe-1

Sign In for Pricing
View Details
RT1-M6-2 3'UTR Luciferase Stable Cell Line
TU219806 1.0 mL

RT1-M6-2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-CACNB1
Y158025 100 µg

Anti-CACNB1

Sign In for Pricing
View Details
R3HDML Protein Vector (Human) (pPB-N-His)
PV056890 500 ng

R3HDML Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details