Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3B Rabbit pAb (APR17883N)

Product Specifications

Background

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3 complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC. The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality eIF3B Rabbit pAb (APR17883N) .

Synonyms

EIF3B; EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1

Gene ID

8662

UniProt

P55884

Cellular Locus

Cytoplasm

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 92kDa/99kDa Observed MW: 125kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8662

Uniprot URL

https://www.uniprot.org/uniprot/P55884

AA Sequence

PVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51E1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
35290151 3x 1.0 µg DNA

OR51E1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human EPHB3 Knockout A549 cell line
GTR15409737 1 Vial

Human EPHB3 Knockout A549 cell line

Sign In for Pricing
View Details
PDGF-B Polyclonal Antibody
JOT-AP07010-01 50ul

PDGF-B Polyclonal Antibody

Sign In for Pricing
View Details
PDGF-B Polyclonal Antibody
JOT-AP07010-02 100ul

PDGF-B Polyclonal Antibody

Sign In for Pricing
View Details
Polyclonal PHAP1 / ANP32A Antibody (C-Terminus)
APR09083G 0.05mg

Polyclonal PHAP1 / ANP32A Antibody (C-Terminus)

Sign In for Pricing
View Details
LINGO1 Antibody
orb1534807 50 µg

LINGO1 Antibody

Sign In for Pricing
View Details