Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC4R Rabbit pAb (APR17849N)

Product Specifications

Background

The protein encoded by this gene is a membrane-bound receptor and member of the melanocortin receptor family. The encoded protein interacts with adrenocorticotropic and MSH hormones and is mediated by G proteins. This is an intronless gene. Defects in this gene are a cause of autosomal dominant obesity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MC4R Rabbit pAb (APR17849N) .

Synonyms

MC4R

Gene ID

4160

UniProt

P32245

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4160

Uniprot URL

https://www.uniprot.org/uniprot/P32245

AA Sequence

MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MUC1 Monoclonal Antibody
AN300416P 100 µL

Recombinant MUC1 Monoclonal Antibody

Sign In for Pricing
View Details
MRAP Antibody
KC-40467-01 50 μL

MRAP Antibody

Sign In for Pricing
View Details
MRAP Antibody
KC-40467-02 100 µL

MRAP Antibody

Sign In for Pricing
View Details
MRAP Antibody
KC-40467-03 1 mL

MRAP Antibody

Sign In for Pricing
View Details
ING -2 TMA+ Salt - yellow -green fluorescent sodium indicator
2013C 500 µg

ING -2 TMA+ Salt - yellow -green fluorescent sodium indicator

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF740 conjugate, 0.1mg/mL
BNC741859-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details