Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC4R Rabbit pAb (APR17849N)

Product Specifications

Background

The protein encoded by this gene is a membrane-bound receptor and member of the melanocortin receptor family. The encoded protein interacts with adrenocorticotropic and MSH hormones and is mediated by G proteins. This is an intronless gene. Defects in this gene are a cause of autosomal dominant obesity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MC4R Rabbit pAb (APR17849N) .

Synonyms

MC4R

Gene ID

4160

UniProt

P32245

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4160

Uniprot URL

https://www.uniprot.org/uniprot/P32245

AA Sequence

MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Heat Shock 70kDa Protein 2 (HSPA2) ELISA Kit
RD-HSPA2-Hu-01 96 Tests

Human Heat Shock 70kDa Protein 2 (HSPA2) ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock 70kDa Protein 2 (HSPA2) ELISA Kit
RD-HSPA2-Hu-02 48 Tests

Human Heat Shock 70kDa Protein 2 (HSPA2) ELISA Kit

Sign In for Pricing
View Details
Neuroligin 1 (NLGN1) (NM_014932) Human Recombinant Protein
TP720411XL 1 mg

Neuroligin 1 (NLGN1) (NM_014932) Human Recombinant Protein

Sign In for Pricing
View Details
Dnajc12 (NM_013888) Mouse Tagged ORF Clone
MG201988 10 µg

Dnajc12 (NM_013888) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human LIMS4 activation kit by CRISPRa
GA119237 1 Kit

Human LIMS4 activation kit by CRISPRa

Sign In for Pricing
View Details
Endo G (ENDOG) Rabbit Polyclonal Antibody
TA367044 100 µL

Endo G (ENDOG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details