Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFALS Rabbit pAb (APR17844N)

Product Specifications

Background

The protein encoded by this gene is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in this gene are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty. Three transcript variants encoding two different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IGFALS Rabbit pAb (APR17844N) .

Synonyms

IGFALS; ACLSD; ALS

Gene ID

3483

UniProt

P35858

Cellular Locus

Secreted, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 66kDa/70kDa Observed MW: 66kDa/72kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3483

Uniprot URL

https://www.uniprot.org/uniprot/P35858

AA Sequence

SCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGPLQRAFWLDVSHNRLEALPNSLLAPLGRLRYLSLRNNSLRTFTPQPPGLERLWLEGNPWDCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC91 Double Nickase Plasmid (m2)
sc-426326-NIC-2 20 µg

CCDC91 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Olfr76 3'UTR Luciferase Stable Cell Line
TU115485 1.0 mL

Olfr76 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ITGAX Antibody
OACD04898-100UL 100 µL

ITGAX Antibody

Sign In for Pricing
View Details
ALOX15B (Arachidonate 15-lipoxygenase B, 15-LOX-B, 15-lipoxygenase 2, 15-LOX-2, Arachidonate 15-lipoxygenase type II) (AP)
MBS6129970-01 0.1 mL

ALOX15B (Arachidonate 15-lipoxygenase B, 15-LOX-B, 15-lipoxygenase 2, 15-LOX-2, Arachidonate 15-lipoxygenase type II) (AP)

Sign In for Pricing
View Details
ALOX15B (Arachidonate 15-lipoxygenase B, 15-LOX-B, 15-lipoxygenase 2, 15-LOX-2, Arachidonate 15-lipoxygenase type II) (AP)
MBS6129970-02 5x 0.1 mL

ALOX15B (Arachidonate 15-lipoxygenase B, 15-LOX-B, 15-lipoxygenase 2, 15-LOX-2, Arachidonate 15-lipoxygenase type II) (AP)

Sign In for Pricing
View Details
ATP-binding cassette sub-family C member 8 (ABCC8) Rat ELISA Kit
B7315 96 Tests

ATP-binding cassette sub-family C member 8 (ABCC8) Rat ELISA Kit

Sign In for Pricing
View Details