Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3F3B Rabbit pAb (APR17841N)

Product Specifications

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is polyadenylated, unlike most histone genes. The protein encoded by this gene is a replication-independent histone that is a member of the histone H3 family. Pseudogenes of this gene have been identified on the X chromosome, and on chromosomes 5, 13 and 17.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality H3F3B Rabbit pAb (APR17841N) .

Synonyms

H3F3B; H3.3B

Gene ID

3021

UniProt

P84243

Cellular Locus

Chromosome, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3021

Uniprot URL

https://www.uniprot.org/uniprot/P84243

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit
MBS2509256-01 24 Tests (Limit 1)

Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit

Sign In for Pricing
View Details
Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit
MBS2509256-02 48 Tests

Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit

Sign In for Pricing
View Details
Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit
MBS2509256-03 96 Tests

Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit

Sign In for Pricing
View Details
Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit
MBS2509256-04 5x 96 Tests

Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit

Sign In for Pricing
View Details
Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit
MBS2509256-05 10x 96 Tests

Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit

Sign In for Pricing
View Details
CD3G Protein Vector (Rat) (pPB-N-His)
PV258619 500 ng

CD3G Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details